Return to main results Retrieve Phyre Job Id

Job DescriptionP75882
Confidence5.47%DateThu Jan 5 12:15:23 GMT 2012
Rank52Aligned Residues58
% Identity26%Templatec1kkeA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:sigma 1 protein; PDBTitle: crystal structure of reovirus attachment protein sigma12 trimer
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   207..210.........220.........230.........240.........250.........260.........270.........280 .....
Predicted Secondary structure 

































.




Query SS confidence 









































































.




Query Sequence  GGIEYQTPWNPLRLKLEYDGNNYQNDFAGKLPQASHFNVGAVYRAASWADLNLSYERGNTLMFGFTLRTNFNDL. RPALR
Query Conservation 


 

     
 
 




  
  
        
 

 
  
       
     

     
     
    . 
   
Alig confidence 
















...................


...































.




Template Conservation 
   
    
 

  
 ...................  
...  


 
 
        

   
   






     
Template Sequence  GIVSYSGSGLNWRVQVN. . . . . . . . . . . . . . . . . . . SDI. . . FIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLL
Template Known Secondary structure  TT......................TT




STTSSB
TT

Template Predicted Secondary structure 



......................














Template SS confidence 















































































   322.......330........ .340. ........350.........360.........370.........
 
   286
Predicted Secondary structure 
Query SS confidence 
Query Sequence  D
Query Conservation   
Alig confidence 
Template Conservation 
Template Sequence  T
Template Known Secondary structure  G
Template Predicted Secondary structure 
Template SS confidence 
   380
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions