Return to main results Retrieve Phyre Job Id

Job DescriptionP33650
Confidence92.50%DateThu Jan 5 11:52:32 GMT 2012
Rank415Aligned Residues37
% Identity22%Templatec1q1bD_
PDB info PDB header:transport proteinChain: D: PDB Molecule:maltose/maltodextrin transport atp-binding protein malk; PDBTitle: crystal structure of e. coli malk in the nucleotide-free form
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50..
Predicted Secondary structure 


















Query SS confidence 















































Query Sequence  TIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQV
Query Conservation   




 

 










    


 





 
 
        
Alig confidence 























...........












Template Conservation 
  
 
 








  
 

  ...........
  
 
   
  
Template Sequence  FVVFVGPSGCGKSTLLRMIAGLET. . . . . . . . . . . ITSGDLFIGEKRM
Template Known Secondary structure 
SGGGSTTTSS
...........

SSTT
Template Predicted Secondary structure 









...........






Template SS confidence 















































   31........40.........50.... .....60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions