Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAS5
Confidence4.82%DateThu Jan 5 11:13:41 GMT 2012
Rank64Aligned Residues33
% Identity39%Templatec2ka2B_
PDB info PDB header:membrane proteinChain: B: PDB Molecule:bcl2/adenovirus e1b 19 kda protein-interacting PDBTitle: solution nmr structure of bnip3 transmembrane peptide dimer2 in detergent micelles with his173-ser172 intermonomer3 hydrogen bond restraints
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   219220.........230.........240.........250.........260......
Predicted Secondary structure 












Query SS confidence 















































Query Sequence  GYFASPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQL
Query Conservation 
  
     
   
         
  

 





 
 
 

  

 
Alig confidence 












.......










........








Template Conservation 



 







.......

 





 
........








Template Sequence  GIFSAEFLKVFLP. . . . . . . SLLLSHLLAIG. . . . . . . . LGIYIGRRL
Template Known Secondary structure 
SSTTTT...............T
Template Predicted Secondary structure 

...............
Template SS confidence 















































   155....160....... ..170........ .180.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions