Return to main results Retrieve Phyre Job Id

Job DescriptionP16869
Confidence5.92%DateThu Jan 5 11:35:50 GMT 2012
Rank51Aligned Residues28
% Identity29%Templatec2vdaB_
PDB info PDB header:protein transportChain: B: PDB Molecule:maltoporin; PDBTitle: solution structure of the seca-signal peptide complex
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30......
Predicted Secondary structure 













Query SS confidence 



































Query Sequence  MLSTQFNRDNQYQAITKPSLLAGCIALALLPSAAFA
Query Conservation         
           

            
 
Alig confidence 







........



















Template Conservation 







........



















Template Sequence  MMITLRKR. . . . . . . . RKLPLAVAVAAGVMSAQAMA
Template Known Secondary structure 







........


TTT





Template Predicted Secondary structure 

........





Template SS confidence 



































   1....... .10.........20........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions