Return to main results Retrieve Phyre Job Id

Job DescriptionQ1PI83
Confidence24.09%DateThu Jan 5 12:33:32 GMT 2012
Rank123Aligned Residues39
% Identity23%Templatec2gaaA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:hypothetical 39.9 kda protein; PDBTitle: crystal structure of yfh7 from saccharomyces cerevisiae: a2 putative p-loop containing kinase with a circular3 permutation.
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   87..90.........100.........110.........120.........130.........140.........150...
Predicted Secondary structure 










































Query SS confidence 


































































Query Sequence  DYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVE
Query Conservation    

 
      
  

  
      
  
      
            
  
 

  
 
  

  
Alig confidence 



















............................


















Template Conservation   
 




       

  
............................
   

  
 


  
   
Template Sequence  LLVYKIDIDYEATEERVAKR. . . . . . . . . . . . . . . . . . . . . . . . . . . . HLQSGLVTTIAEGREKFRS
Template Known Secondary structure 

............................TS
SS
Template Predicted Secondary structure 


............................





Template SS confidence 


































































   290.........300......... 310.........320........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions