Return to main results Retrieve Phyre Job Id

Job DescriptionQ1PI83
Confidence69.83%DateThu Jan 5 12:33:32 GMT 2012
Rank101Aligned Residues54
% Identity20%Templatec1ueiB_
PDB info PDB header:transferaseChain: B: PDB Molecule:uridine-cytidine kinase 2; PDBTitle: crystal structure of human uridine-cytidine kinase 22 complexed with a feedback-inhibitor, utp
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   86...90.........100.........110.........120.........130.........140.........150.........160.....
Predicted Secondary structure 











































Query SS confidence 















































































Query Sequence  VDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYY
Query Conservation     

 
      
  

  
      
  
      
            
  
 

  
 
  

  
     

   
Alig confidence 




















............................






























Template Conservation      
 
    
    
   
............................
   
    
                 
   
Template Sequence  FQMKLFVDTDADTRLSRRVLR. . . . . . . . . . . . . . . . . . . . . . . . . . . . DISERGRDLEQILSQYITFVKPAFEEFCLPT
Template Known Secondary structure 
S

............................S


TTTGGG
Template Predicted Secondary structure 



............................



Template SS confidence 















































































   149150.........160......... 170.........180.........190.........200
 
   166.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  SK
Query Conservation   
Alig confidence 

Template Conservation    
Template Sequence  KK
Template Known Secondary structure  GG
Template Predicted Secondary structure 
Template SS confidence 

   201.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions