Return to main results Retrieve Phyre Job Id

Job DescriptionP04805
Confidence31.80%DateThu Jan 5 10:58:21 GMT 2012
Rank93Aligned Residues46
% Identity13%Templatec1h3oA_
PDB info PDB header:transcription/tbp-associated factorsChain: A: PDB Molecule:transcription initiation factor tfiid 135 kda PDBTitle: crystal structure of the human taf4-taf122 (tafii135-tafii20) complex
Resolution2.3 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   402.......410.........420.........430.........440.........450.........460......
Predicted Secondary structure 












Query SS confidence 
































































Query Sequence  TAENVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALDFIAE
Query Conservation    
 
   
  


  


 
  
  

 

 
   

 
   
  



 

 

  

  
 
Alig confidence 

















...............











....















Template Conservation      

 

  
  
 

...............

   

  


....

 




 





 
Template Sequence  LQAPLQRRILEIGKKHGI. . . . . . . . . . . . . . . TELHPDVVSYVS. . . . HATQQRLQNLVEKISE
Template Known Secondary structure 
TTT
...............



TT....
Template Predicted Secondary structure 



...............



....
Template SS confidence 
































































   872.......880......... 890.........900. ........910.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions