Return to main results Retrieve Phyre Job Id

Job DescriptionP76544
Confidence2.95%DateThu Jan 5 12:24:19 GMT 2012
Rank52Aligned Residues29
% Identity14%Templatec2q43A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:iaa-amino acid hydrolase ilr1-like 2; PDBTitle: ensemble refinement of the protein crystal structure of iaa-aminoacid2 hydrolase from arabidopsis thaliana gene at5g56660
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51........60......... 70.........
Predicted Secondary structure 
.................




Query SS confidence 


















. . . . . . . . . . . . . . . . .









Query Sequence  SEEEKLFVKRLKLIKADIH. . . . . . . . . . . . . . . . . AQLKACDCDI
Query Conservation 



 





 

 



................. 

 





Alig confidence 


















.................









Template Conservation            
  
   
   
  
  
   
  
   
   
   
Template Sequence  FAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKY
Template Known Secondary structure  SS


TT

T
Template Predicted Secondary structure 








Template SS confidence 













































   20.........30.........40.........50.........60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions