Return to main results Retrieve Phyre Job Id

Job DescriptionP31470
Confidence9.87%DateThu Jan 5 11:47:59 GMT 2012
Rank88Aligned Residues30
% Identity23%Templatec3fvqB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:fe(3+) ions import atp-binding protein fbpc; PDBTitle: crystal structure of the nucleotide binding domain fbpc2 complexed with atp
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   192.......200.........210.........220.........230.....
Predicted Secondary structure 















Query SS confidence 











































Query Sequence  IVSGAGKAQALKNVLQGPVTEDVPASVLQLHPSLMVIADKAAAA
Query Conservation 

 
  
  

  

 
      


 
  
    

 

 

 
Alig confidence 



















..............









Template Conservation 




 


 




   
 ..............








 
Template Sequence  LSGGQQQRAALARALAPDPE. . . . . . . . . . . . . . LILLDEPFSA
Template Known Secondary structure  S
TT

S..............STTTT
Template Predicted Secondary structure 




..............




Template SS confidence 











































   139140.........150........ .160........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions