Return to main results Retrieve Phyre Job Id

Job DescriptionP31470
Confidence10.15%DateThu Jan 5 11:47:59 GMT 2012
Rank86Aligned Residues29
% Identity17%Templatec2pcjB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:lipoprotein-releasing system atp-binding protein lold; PDBTitle: crystal structure of abc transporter (aq_297) from aquifex aeolicus2 vf5
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   192.......200.........210.........220.........230....
Predicted Secondary structure 















Query SS confidence 










































Query Sequence  IVSGAGKAQALKNVLQGPVTEDVPASVLQLHPSLMVIADKAAA
Query Conservation 

 
  
  

  

 
      


 
  
    

 

 

Alig confidence 



















..............








Template Conservation 

 
   

 




   
 ..............






  
Template Sequence  LSGGEQQRVAIARALANEPI. . . . . . . . . . . . . . LLFADEPTG
Template Known Secondary structure  S
TT

S..............STTT
Template Predicted Secondary structure 




..............



Template SS confidence 










































   141........150.........160 .........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions