Return to main results Retrieve Phyre Job Id

Job DescriptionP31470
Confidence11.50%DateThu Jan 5 11:47:59 GMT 2012
Rank75Aligned Residues32
% Identity22%Templatec2ghiD_
PDB info PDB header:transport proteinChain: D: PDB Molecule:transport protein; PDBTitle: crystal structure of plasmodium yoelii multidrug resistance2 protein 2
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   192.......200.........210.........220.........230.......
Predicted Secondary structure 
















Query SS confidence 













































Query Sequence  IVSGAGKAQALKNVLQGPVTEDVPASVLQLHPSLMVIADKAAAAEL
Query Conservation 

 
  
  

  

 
      


 
  
    

 

 

  
Alig confidence 



















..............











Template Conservation 

 
   

 

 

   
 ..............







    
Template Sequence  LSGGERQRIAIARCLLKDPK. . . . . . . . . . . . . . IVIFDDSKTEYL
Template Known Secondary structure 

T

S..............

Template Predicted Secondary structure 










..............





Template SS confidence 













































   156...160.........170..... ....180.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions