Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9Q7
Confidence82.78%DateThu Jan 5 11:11:00 GMT 2012
Rank153Aligned Residues52
% Identity23%Templatec3k2qA_
PDB info PDB header:transferaseChain: A: PDB Molecule:pyrophosphate-dependent phosphofructokinase; PDBTitle: crystal structure of pyrophosphate-dependent2 phosphofructokinase from marinobacter aquaeolei, northeast3 structural genomics consortium target mqr88
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   523......530.........540.........550.........560.........570.........580.........590........
Predicted Secondary structure 




































Query SS confidence 











































































Query Sequence  SIVRKGAELANSFKPDVIIALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTT
Query Conservation    
            
 







 

 

 

                                  
 





Alig confidence 




































........................














Template Conservation       
   
    

 

 





   
  
    ........................      
 






Template Sequence  REYERLIEVFRAHDIGYFFYNGGGDSQDTAYKVSQLA. . . . . . . . . . . . . . . . . . . . . . . . DRMGYPITCIGVPKT
Template Known Secondary structure 
TTS........................TT



B
Template Predicted Secondary structure 





........................





Template SS confidence 











































































   91........100.........110.........120....... ..130.........140..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions