Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9Q7
Confidence77.65%DateThu Jan 5 11:11:00 GMT 2012
Rank177Aligned Residues50
% Identity22%Templatec2higA_
PDB info PDB header:transferaseChain: A: PDB Molecule:6-phospho-1-fructokinase; PDBTitle: crystal structure of phosphofructokinase apoenzyme from trypanosoma2 brucei.
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   525....530.........540.........550.........560.........570.........580.........590........
Predicted Secondary structure 




































Query SS confidence 









































































Query Sequence  VRKGAELANSFKPDVIIALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTT
Query Conservation 
            
 







 

 

 

                                  
 





Alig confidence 































..........





..............











Template Conservation     
   
    
  

 





   
  
 ..........      ..............   
 






Template Sequence  PKEMVDTLERLGVNILFTVGGDGTQRGALVIS. . . . . . . . . . QEAKRR. . . . . . . . . . . . . . GVDISVFGVPKT
Template Known Secondary structure  T
S
........................T




Template Predicted Secondary structure 





..........
..............






Template SS confidence 









































































   178.180.........190.........200......... 210..... ....220.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions