Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9Q7
Confidence30.68%DateThu Jan 5 11:11:00 GMT 2012
Rank461Aligned Residues39
% Identity23%Templatec2hc9A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:leucine aminopeptidase 1; PDBTitle: structure of caenorhabditis elegans leucine aminopeptidase-zinc2 complex (lap1)
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   495....500.........510.........520.........530.........540.......
Predicted Secondary structure 


















Query SS confidence 




















































Query Sequence  YADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDVIIALGGGS
Query Conservation      
   
   

   

  
  

    
            
 







Alig confidence 




















..............

















Template Conservation   
  
       
  
 

  ..............  
   


 




 

Template Sequence  LVDEAVKVGNATGSKITVIRG. . . . . . . . . . . . . . EELLKAGFGGIYHVGKAG
Template Known Secondary structure  TT
T..............T
TTS
Template Predicted Secondary structure 


..............







Template SS confidence 




















































   189190.........200......... 210.........220.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions