Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9Q7
Confidence86.25%DateThu Jan 5 11:11:00 GMT 2012
Rank137Aligned Residues48
% Identity19%Templatec1zxxA_
PDB info PDB header:transferaseChain: A: PDB Molecule:6-phosphofructokinase; PDBTitle: the crystal structure of phosphofructokinase from lactobacillus2 delbrueckii
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   521........530.........540.........550.........560.........570.........580.........590........
Predicted Secondary structure 





































Query SS confidence 













































































Query Sequence  TLSIVRKGAELANSFKPDVIIALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTT
Query Conservation      
            
 







 

 

 

                                  
 





Alig confidence 



































..............................











Template Conservation             
    

 





 

   
  
 ..............................   
 






Template Sequence  EEEGQLAGIEQLKKHGIDAVVVIGGDGSYHGALQLT. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RHGFNSIGLPGT
Template Known Secondary structure  STT


..............................TT

Template Predicted Secondary structure 






..............................





Template SS confidence 













































































   78.80.........90.........100.........110... ......120.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions