Return to main results Retrieve Phyre Job Id

Job DescriptionP77301
Confidence17.70%DateThu Jan 5 12:27:28 GMT 2012
Rank25Aligned Residues45
% Identity20%Templatec2ad5B_
PDB info PDB header:ligaseChain: B: PDB Molecule:ctp synthase; PDBTitle: mechanisms of feedback regulation and drug resistance of ctp2 synthetases: structure of the e. coli ctps/ctp complex at 2.8-3 angstrom resolution.
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.........60........
Predicted Secondary structure 























Query SS confidence 




























































Query Sequence  KTLWAALRGNHYTWPAIDITLPGNRHFHLIGSIHMGSHDMAPLPTRLLKKLKNADALIVEA
Query Conservation                

 
    
    

 




           
  
   

 
 


Alig confidence 










................

































Template Conservation    

 


 
 ................


 






 
  
   
       
  
 
 
Template Sequence  SDVLRKERRGD. . . . . . . . . . . . . . . . YLGATVQVIPHITNAIKERVLEGGEGHDVVLVEI
Template Known Secondary structure  TTT................TTT



TTTSS
S
Template Predicted Secondary structure 


................














Template SS confidence 




























































   97..100....... ..110.........120.........130.........140.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions