Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionQ47377
DateThu Jan 5 12:36:46 GMT 2012
Unique Job ID7adc323ff16906c6

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template d1s7ba_
Top template information
Fold:Multidrug resistance efflux transporter EmrE
Superfamily:Multidrug resistance efflux transporter EmrE
Family:Multidrug resistance efflux transporter EmrE
Confidence and coverage
Confidence: 99.5% Coverage: 88%
98 residues ( 88% of your sequence) have been modelled with 99.5% confidence by the single highest scoring template.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.........40.........50.........60
Sequence  MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN
Secondary structure 





SS confidence 



























































Disorder  ?






















?
????





?






















Disorder confidence 



























































 
   .........70.........80.........90.........100.........110.
Sequence  VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Secondary structure 







SS confidence 


















































Disorder 















































???
Disorder confidence 


















































 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region

PDB 1s7b chain A

3D model

Region: 4 - 110
Aligned: 98
Modelled: 107
Confidence: 99.5%
Identity: 24%
Fold: Multidrug resistance efflux transporter EmrE
Superfamily: Multidrug resistance efflux transporter EmrE
Family: Multidrug resistance efflux transporter EmrE

Phyre2

PDB 2i68 chain B

3D model

Region: 3 - 108
Aligned: 75
Modelled: 81
Confidence: 97.7%
Identity: 25%
PDB header:transport protein
Chain: B: PDB Molecule:protein emre;
PDBTitle: cryo-em based theoretical model structure of transmembrane2 domain of the multidrug-resistance antiporter from e. coli3 emre

Phyre2
1

d1s7ba_
2

c2i68B_



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information
1d1s7ba_



99.5 24 Fold:Multidrug resistance efflux transporter EmrE
Superfamily:Multidrug resistance efflux transporter EmrE
Family:Multidrug resistance efflux transporter EmrE
2c2i68B_



97.7 25 PDB header:transport protein
Chain: B: PDB Molecule:protein emre;
PDBTitle: cryo-em based theoretical model structure of transmembrane2 domain of the multidrug-resistance antiporter from e. coli3 emre

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite



Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
If you use the binding site predictions from 3DLigandSite, please also cite:
3DLigandSite: predicting ligand-binding sites using similar structures.
Wass MN, Kelley LA and Sternberg MJ Nucleic Acids Research 38, W469-73 (2010) [PubMed]
 
© Structural Bioinformatics Group
Imperial College London
Lawrence Kelley, Benjamin Jefferys
Disclaimer
Terms and Conditions
Component software
Template detection: HHpred 1.51
Secondary structure prediction: Psi-pred 2.5
Disorder prediction: Disopred 2.4
Transmembrane prediction: Memsat_SVM
Multi-template modelling and ab initio: Poing 1.0