Return to main results Retrieve Phyre Job Id

Job DescriptionQ47377
Confidence97.68%DateThu Jan 5 12:36:46 GMT 2012
Rank2Aligned Residues75
% Identity25%Templatec2i68B_
PDB info PDB header:transport proteinChain: B: PDB Molecule:protein emre; PDBTitle: cryo-em based theoretical model structure of transmembrane2 domain of the multidrug-resistance antiporter from e. coli3 emre
ResolutionNULL Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60.........70. ........80.
Predicted Secondary structure 



.
Query SS confidence 




































































.









Query Sequence  WLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQNVPVGIAYPMLS. LNFVWVTLAA
Query Conservation   

 
    
   



 
                
    
   
    

   

   


 
 

 
.
  
   
 
Alig confidence 




















....................















.....






.









Template Conservation 
  
  

  




  
  
....................  

  


 

  
 .....







 







 
Template Sequence  YIYLGGAILAEVIGTTLMVGT. . . . . . . . . . . . . . . . . . . . IICYCASFWLLAQTLA. . . . . IAYAIWSGVGIVLISLLS
Template Known Secondary structure 


....................
.....
Template Predicted Secondary structure 
.........................
Template SS confidence 















































































   4.....10.........20.... .....30.........40 .........50........
 
   82.......90.........100........
Predicted Secondary structure 




Query SS confidence 


























Query Sequence  VKLWHEPVSPRHWCGVAFIIGGIVILG
Query Conservation     
 
 
      
  

  

 


Alig confidence 




......















Template Conservation      
......

 

 









Template Sequence  WGFFG. . . . . . AIIGMMLICAGVLIIN
Template Known Secondary structure 
......
Template Predicted Secondary structure  ......
Template SS confidence 


























   76...80 .........90......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions