Return to main results Retrieve Phyre Job Id

Job DescriptionP39374
Confidence3.45%DateThu Jan 5 12:00:06 GMT 2012
Rank86Aligned Residues36
% Identity28%Templatec2fwmX_
PDB info PDB header:oxidoreductaseChain: X: PDB Molecule:2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; PDBTitle: crystal structure of e. coli enta, a 2,3-dihydrodihydroxy benzoate2 dehydrogenase
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   190.........200.........210.........220.........230.........240.........
Predicted Secondary structure 

























Query SS confidence 



























































Query Sequence  DQIMTVTGVANSSGFALAALLNANIELGNDPIIGIEAYPGTAEIHAKMGYKVIPGDENAP
Query Conservation 


 







 

 






   
  
  


 
   

 
 
 

   

      
Alig confidence 




















........................














Template Conservation 









 


 
 
  
........................
  

 

   
   
Template Sequence  GKNVWVTGAGKGIGYATALAF. . . . . . . . . . . . . . . . . . . . . . . . VEAGAKVTGFDQAFT
Template Known Secondary structure  T
STTS........................TT
S


Template Predicted Secondary structure 





........................




Template SS confidence 



























































   5....10.........20..... ....30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions