Return to main results Retrieve Phyre Job Id

Job DescriptionP76347
Confidence26.76%DateWed Jan 25 15:21:07 GMT 2012
Rank188Aligned Residues31
% Identity13%Templatec1r13A_
PDB info PDB header:sugar binding proteinChain: A: PDB Molecule:pulmonary surfactant-associated protein a; PDBTitle: carbohydrate recognition and neck domains of surfactant protein a (sp-2 a)
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2246...2250.........2260.........2270.........2280.....
Predicted Secondary structure 
















Query SS confidence 







































Query Sequence  PSYVYEIRVKSWWVNAGEAFMIYSLAENFCSSNGYTLPRA
Query Conservation                                          
Alig confidence 










.........



















Template Conservation     

      .........  
  
   
   

 

 
Template Sequence  GDKVFSTNGQS. . . . . . . . . VNFDTIKEMCTRAGGNIAVP
Template Known Secondary structure  TT.........
TTS


Template Predicted Secondary structure 



.........





Template SS confidence 







































   115....120..... ....130.........140.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions