Return to main results Retrieve Phyre Job Id

Job DescriptionP76347
Confidence45.88%DateWed Jan 25 15:21:07 GMT 2012
Rank119Aligned Residues28
% Identity21%Templatec1g1qD_
PDB info PDB header:immune system, membrane proteinChain: D: PDB Molecule:p-selectin; PDBTitle: crystal structure of p-selectin lectin/egf domains
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22492250.........2260.........2270.........2280.....
Predicted Secondary structure 















Query SS confidence 




































Query Sequence  VYEIRVKSWWVNAGEAFMIYSLAENFCSSNGYTLPRA
Query Conservation                                       
Alig confidence 







.........



















Template Conservation   
      ......... 

  
   
    
 

 
Template Sequence  TYHYSTKA. . . . . . . . . YSWNISRKYCQNRYTDLVAI
Template Known Secondary structure  .........
SS


Template Predicted Secondary structure 


.........




Template SS confidence 




































   2....... 10.........20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions