Return to main results Retrieve Phyre Job Id

Job DescriptionP76347
Confidence72.15%DateWed Jan 25 15:21:07 GMT 2012
Rank70Aligned Residues29
% Identity28%Templatec1eslA_
PDB info PDB header:cell adhesion proteinChain: A: PDB Molecule:human e-selectin; PDBTitle: insight into e-selectin(slash)ligand interaction from the2 crystal structure and mutagenesis of the lec(slash)egf3 domains
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2248.2250.........2260.........2270.........2280.....
Predicted Secondary structure 















Query SS confidence 





































Query Sequence  YVYEIRVKSWWVNAGEAFMIYSLAENFCSSNGYTLPRA
Query Conservation                                        
Alig confidence 








.........



















Template Conservation    
      .........  
  
   
   

 

 
Template Sequence  WSYNTSTEA. . . . . . . . . MTYDEASAYCQQRYTHLVAI
Template Known Secondary structure 

SS
.........B
SS


Template Predicted Secondary structure 



.........




Template SS confidence 





































   1........ 10.........20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions