Return to main results Retrieve Phyre Job Id

Job DescriptionP25772
Confidence23.33%DateThu Jan 5 11:42:38 GMT 2012
Rank213Aligned Residues35
% Identity23%Templatec3m6cA_
PDB info PDB header:chaperoneChain: A: PDB Molecule:60 kda chaperonin 1; PDBTitle: crystal structure of mycobacterium tuberculosis groel1 apical domain
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60.........70.
Predicted Secondary structure 







Query SS confidence 













































Query Sequence  SPARAQEEISRLQQQIKQWDDDYWKEGKSEVEDGVYDQLSARLTQW
Query Conservation          
  
   
      

    
 


 


 
  

  
Alig confidence 

















...........
















Template Conservation      
  

  
   
  ...........
 
   



 





Template Sequence  TAEAVANRAKHLRAEIDK. . . . . . . . . . . SDSDWDREKLGERLAKL
Template Known Secondary structure 
T...........


Template Predicted Secondary structure 
...........


Template SS confidence 













































   336...340.........350... ......360.........370
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions