Return to main results Retrieve Phyre Job Id

Job DescriptionP25772
Confidence36.32%DateThu Jan 5 11:42:38 GMT 2012
Rank183Aligned Residues46
% Identity22%Templatec3fblA_
PDB info PDB header:structural proteinChain: A: PDB Molecule:putative uncharacterized protein; PDBTitle: crystal structure of orf132 of the archaeal virus acidianus2 filamentous virus 1 (afv1)
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   493.... ..500........ .510.........520.........530........
Predicted Secondary structure 


........


.........






Query SS confidence 




. . . . . . . .










. . . . . . . . .





























Query Sequence  GIPLT. . . . . . . . RAALNASDERS. . . . . . . . . WSQLLFSTEQFWQQLPGTGSGRARQVIEWK
Query Conservation 

  
........
   

    
.........
  
  

 
 
  
 


   
 

  

Alig confidence 




........










.........





























Template Conservation 






























































Template Sequence  GIPNIKWGMYIAFGEKLLKSYLKMKAGSASSDMIAEYINNAISAFSSRTGISQETAQKIADFI
Template Known Secondary structure  T

GGGTT

TSTT

Template Predicted Secondary structure 













Template SS confidence 






























































   66...70.........80.........90.........100.........110.........120........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions