Return to main results Retrieve Phyre Job Id

Job DescriptionP25772
Confidence66.15%DateThu Jan 5 11:42:38 GMT 2012
Rank132Aligned Residues59
% Identity12%Templatec2oceA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein pa5201; PDBTitle: crystal structure of tex family protein pa5201 from2 pseudomonas aeruginosa
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   450.........460.........470.........480.........490.........500.........510.........520.........
Predicted Secondary structure 


























Query SS confidence 















































































Query Sequence  SWLLLTPEQLQNTPGIAKSKSAQLWHQFNLARKQPFTRWVMAMGIPLTRAALNASDERSWSQLLFSTEQFWQQLPGTGSG
Query Conservation 

  
  
 
  
 


 


 

   

 

   
 
 
 



  

   

    

  
  

 
 
  
 


  
Alig confidence 

































...............................














Template Conservation 


 

  

  
 






  

  
   
 
............................... 

  
  
  

 
Template Sequence  DVNTASAALLARISGLNSTLAQNIVAHRDANGAF. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RTRDELKKVSRLGEK
Template Known Secondary structure 
TTT

TSTT




...............................SSGGGGGGSSS

Template Predicted Secondary structure 








...............................






Template SS confidence 















































































   501........510.........520.........530.... .....540.........
 
   530.........
Predicted Secondary structure 
Query SS confidence 









Query Sequence  RARQVIEWKE
Query Conservation   
 

  

 
Alig confidence 









Template Conservation 

 






Template Sequence  TFEQAAGFLR
Template Known Secondary structure  TTTB
Template Predicted Secondary structure 


Template SS confidence 









   550.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions