Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABN5
Confidence27.50%DateThu Jan 5 11:15:55 GMT 2012
Rank12Aligned Residues23
% Identity30%Templatec3ozqA_
PDB info PDB header:hydrolase inhibitorChain: A: PDB Molecule:serpin48; PDBTitle: crystal structure of serpin48, which is a highly specific serpin in2 the insect tenebrio molitor
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   389390........ .400.. .......410.
Predicted Secondary structure 




.....



....






Query SS confidence 









. . . . .



. . . .








Query Sequence  AAVQMDDTGT. . . . . TRIG. . . . KFVFNHPFF
Query Conservation 


 

 


.....



....
 
 




Alig confidence 









.....



....








Template Conservation    
 
 
 

 
   
        
  




Template Sequence  SFIDVSEEGVEAAAATYIPVSPKQFIVDHPFI
Template Known Secondary structure 
SSS












S
Template Predicted Secondary structure 



















Template SS confidence 































   330.........340.........350.........360.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions