Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABN5
Confidence9.17%DateThu Jan 5 11:15:55 GMT 2012
Rank67Aligned Residues34
% Identity29%Templatec2o01F_
PDB info PDB header:photosynthesisChain: F: PDB Molecule:photosystem i reaction center subunit iii, PDBTitle: the structure of a plant photosystem i supercomplex at 3.42 angstrom resolution
Resolution3.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   383......390.........400.........410.........420.......
Predicted Secondary structure 




















Query SS confidence 












































Query Sequence  TYPTLVAAVQMDDTGTTRIGKFVFNHPFFIPGTLGVALAVCFGFV
Query Conservation   


 



 

 







 
 









 
  

  
  
Alig confidence 















...........

















Template Conservation 





 

   



...........
 

 












Template Sequence  GLPHLIVSGDQRHWGE. . . . . . . . . . . FITPGILFLYIAGWIGWV
Template Known Secondary structure  TB




SS
TTTTTS...........SSTTTTTT
Template Predicted Secondary structure 







...........
Template SS confidence 












































   67..70.........80.. .......90.........100
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions