Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABN5
Confidence6.49%DateThu Jan 5 11:15:55 GMT 2012
Rank95Aligned Residues37
% Identity24%Templatec1zxoB_
PDB info PDB header:unknown functionChain: B: PDB Molecule:conserved hypothetical protein q8a1p1; PDBTitle: x-ray crystal structure of protein q8a1p1 from bacteroides2 thetaiotaomicron. northeast structural genomics consortium3 target btr25.
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   104.....110.........120.........130.........140.........150..
Predicted Secondary structure 






Query SS confidence 
















































Query Sequence  TGNISLATLPVIAEVAKEQGVKPCRPLSTAVVSAQIAITASPISAAVVY
Query Conservation 

 
  
 



 


   








 





 

 







  
Alig confidence 



























............








Template Conservation 




      

         
  
  ............ 
  

  
Template Sequence  IGSIAYCYKEILQDAARQTGIQIGKILQ. . . . . . . . . . . . SPXEGLIQY
Template Known Secondary structure  STTT

S............
TT
Template Predicted Secondary structure 










............
Template SS confidence 
















































   239240.........250.........260...... ...270.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions