Return to main results Retrieve Phyre Job Id

Job DescriptionP23862
Confidence1.76%DateThu Jan 5 11:40:03 GMT 2012
Rank76Aligned Residues41
% Identity15%Templatec1l6lK_
PDB info PDB header:lipid transportChain: K: PDB Molecule:apolipoprotein a-ii; PDBTitle: structures of apolipoprotein a-ii and a lipid surrogate2 complex provide insights into apolipoprotein-lipid3 interactions
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50... ......60.........70......
Predicted Secondary structure  ...............
Query SS confidence 

















. . . . . . . . . . . . . . .






















Query Sequence  RHLFQTRATTLQACLDEA. . . . . . . . . . . . . . . GDNLAALRHAVEQQQLPQVAWLA
Query Conservation    

      
     

...............  
   
              
 
Alig confidence 

















...............






















Template Conservation    
  




 


 


  








 
  
 




















Template Sequence  ESLVSQYFQTVTDYGKDLMEKVKSPELQAKSYFEKSKEQLTPLIKKAGTELVNFLS
Template Known Secondary structure  TTTTS

S


T
Template Predicted Secondary structure 
Template SS confidence 























































   8.10.........20.........30.........40.........50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions