Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABD5
Confidence23.46%DateWed Jan 25 15:20:22 GMT 2012
Rank190Aligned Residues28
% Identity36%Templated1knxa1
SCOP infoMurF and HprK N-domain-like HprK N-terminal domain-like HPr kinase/phoshatase HprK N-terminal domain
Resolution2.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   112.......120.........130.........140.........150.........
Predicted Secondary structure 






















Query SS confidence 















































Query Sequence  PVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIIT
Query Conservation   
 


   
           
   
 
  

 
   

    



 
Alig confidence 






..............





......














Template Conservation 
 



 ..............    
 ...... 
   
    



 
Template Sequence  PAIILTK. . . . . . . . . . . . . . SFTDPT. . . . . . VLLQVNQTYQVPILK
Template Known Secondary structure  S
T..............TT


......GGGT


Template Predicted Secondary structure 

..............




......


Template SS confidence 















































   85....90. ...... ..100.........110..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions