Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABD5
Confidence20.62%DateWed Jan 25 15:20:22 GMT 2012
Rank203Aligned Residues31
% Identity26%Templatec3louB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:formyltetrahydrofolate deformylase; PDBTitle: crystal structure of formyltetrahydrofolate deformylase (yp_105254.1)2 from burkholderia mallei atcc 23344 at 1.90 a resolution
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   106...110.........120.........130.........140.........150.........160
Predicted Secondary structure 
























Query SS confidence 






















































Query Sequence  ARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITF
Query Conservation 


 
  
 


   
           
   
 
  

 
   

    



 
Alig confidence 














........................















Template Conservation 
 
  

  



  ........................     
   


   
Template Sequence  GELKXDIVGIVSNHP. . . . . . . . . . . . . . . . . . . . . . . . DFAPLAAQHGLPFRHF
Template Known Secondary structure  TSS

SSS........................TTTT


Template Predicted Secondary structure 







........................



Template SS confidence 






















































   118.120.........130.. .......140........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions