Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABD5
Confidence20.58%DateWed Jan 25 15:20:22 GMT 2012
Rank204Aligned Residues35
% Identity34%Templatec3eywA_
PDB info PDB header:transport proteinChain: A: PDB Molecule:c-terminal domain of glutathione-regulated potassium-efflux PDBTitle: crystal structure of the c-terminal domain of e. coli kefc in complex2 with keff
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   101....... .110.........120.........130.........140.........150.........
Predicted Secondary structure  ..........
























Query SS confidence 







. . . . . . . . . .


















































Query Sequence  IVGGIARL. . . . . . . . . . DGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIIT
Query Conservation 

 
 


.......... 
  
 


   
           
   
 
  

 
   

    



 
Alig confidence 







..........











........................














Template Conservation 

 
 




 


 
   
  




 
 ........................  
  
   
  

 
Template Sequence  IIAGFGRFGQITGRLLLSSGVKMVVLDHDP. . . . . . . . . . . . . . . . . . . . . . . . DHIETLRKFGMKVFY
Template Known Secondary structure 

STT

S
........................TT


Template Predicted Secondary structure 








........................


Template SS confidence 




































































   403......410.........420.........430.. .......440.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions