Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABD5
Confidence49.05%DateWed Jan 25 15:20:22 GMT 2012
Rank138Aligned Residues32
% Identity25%Templatec3cf4G_
PDB info PDB header:oxidoreductaseChain: G: PDB Molecule:acetyl-coa decarboxylase/synthase epsilon subunit; PDBTitle: structure of the codh component of the m. barkeri acds complex
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   111........120.........130.........140.........150.........
Predicted Secondary structure 






















Query SS confidence 
















































Query Sequence  RPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIIT
Query Conservation    
 


   
           
   
 
  

 
   

    



 
Alig confidence 







..............










...












Template Conservation   





 .............. 
        
...  
 
   


 
Template Sequence  RPLLMVGT. . . . . . . . . . . . . . LALDPELLDRV. . . VKISKAANIPIAA
Template Known Secondary structure  S
S..............TT

...T

Template Predicted Secondary structure 


..............

...


Template SS confidence 
















































   36...40... ......50.... .....60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions