Return to main results Retrieve Phyre Job Id

Job DescriptionP77162
Confidence3.52%DateThu Jan 5 12:25:48 GMT 2012
Rank89Aligned Residues26
% Identity19%Templatec3fz5C_
PDB info PDB header:isomeraseChain: C: PDB Molecule:possible 2-hydroxychromene-2-carboxylate isomerase; PDBTitle: crystal structure of possible 2-hydroxychromene-2-carboxylate2 isomerase from rhodobacter sphaeroides
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   87..90.........100.........110.........120.
Predicted Secondary structure 






















Query SS confidence 


































Query Sequence  TVVMDHQQYIIPSSLGWRNGDNAWFDFISNISEAG
Query Conservation   

 
   
  
  
  
 
 
    

  



 
Alig confidence 









.........















Template Conservation 



 
    .........
 

       
    
Template Sequence  FFLVDDEPFW. . . . . . . . . GWDRXEXXAEWIRTGG
Template Known Secondary structure  TT.........SGGGT
Template Predicted Secondary structure 

.........







Template SS confidence 


































   173......180.. .......190........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions