Return to main results Retrieve Phyre Job Id

Job DescriptionP38054
Confidence10.78%DateThu Jan 5 11:57:54 GMT 2012
Rank84Aligned Residues53
% Identity11%Templatec2wzoA_
PDB info PDB header:cell cycleChain: A: PDB Molecule:transforming growth factor beta regulator 1; PDBTitle: the structure of the fyr domain
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   100.........110.........120.........130.........140.........150.........160.........170......
Predicted Secondary structure 





























Query SS confidence 












































































Query Sequence  GTDPYWARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIYEYALVDRSGKHDLADLRSLQDWFLKYELKTIPDVAE
Query Conservation        
   
   
      

                                 
           
  
 

  
Alig confidence 




















........................































Template Conservation 
 

   
  

  
      ........................      


   



 
 
  






   
Template Sequence  SSSADACHAELLRTISTTMGK. . . . . . . . . . . . . . . . . . . . . . . . LMPNLLPAGADFFGFSHPAIHNLIQSCPGARK
Template Known Secondary structure  SST
........................

TT



TTTSTTSTTGGG
Template Predicted Secondary structure 



........................












Template SS confidence 












































































   261........270.........280. ........290.........300.........310...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions