Return to main results Retrieve Phyre Job Id

Job DescriptionP76491
Confidence93.65%DateThu Jan 5 12:23:33 GMT 2012
Rank34Aligned Residues34
% Identity32%Templatec3bg2A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:dgtp triphosphohydrolase; PDBTitle: crystal structure of deoxyguanosinetriphosphate triphosphohydrolase2 from flavobacterium sp. med217
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50....... ..60.........70.
Predicted Secondary structure 







...................
Query SS confidence 

























. . . . . . . . . . . . . . . . . . .













Query Sequence  EHSLQVAMVAHALAAIKNRKFGGNVN. . . . . . . . . . . . . . . . . . . AERIALLAMYHDAS
Query Conservation 


  

 

  

          

...................       

 


 
Alig confidence 
















......


...................













Template Conservation 






 


 
   
......                        






 



Template Sequence  THSLEVSVVGRSLGRMV. . . . . . GKKLLEKYPHLEQVYGYKFNDFGAIVAAAALAHDIG
Template Known Secondary structure  ......STTT


TTTT
Template Predicted Secondary structure  ......
















Template SS confidence 


























































   67..70.........80... ......90.........100.........110.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions