Return to main results Retrieve Phyre Job Id

Job DescriptionP76491
Confidence3.79%DateThu Jan 5 12:23:33 GMT 2012
Rank87Aligned Residues49
% Identity20%Templatec1ekuA_
PDB info PDB header:immune systemChain: A: PDB Molecule:interferon gamma; PDBTitle: crystal structure of a biologically active single chain2 mutant of human ifn-gamma
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   67..70.........80.........90.........100.........110.........120.........130.........140..
Predicted Secondary structure 





















Query SS confidence 











































































Query Sequence  YHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLIDEHAYSDEEKSLVKQADALCAY
Query Conservation   


 
   


  
 
             
  
   
   



               
 

 


 

 
 
 
Alig confidence 













................




...........





























Template Conservation     
    
 
   ................

 

........... 

  
    
         




 

 
Template Sequence  FEKLTNYSVTDLNV. . . . . . . . . . . . . . . . QRKAI. . . . . . . . . . . DELIQVMAEFSTEEQQEGPYVKEAENLKKY
Template Known Secondary structure  TS
SS
...........................TTSSS



SST
Template Predicted Secondary structure 



...........................





Template SS confidence 











































































   92.......100..... ....110 .........120.........130.........140
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions