Return to main results Retrieve Phyre Job Id

Job DescriptionP75783
Confidence22.74%DateThu Jan 5 12:14:05 GMT 2012
Rank282Aligned Residues55
% Identity13%Templatec3o9pA_
PDB info PDB header:peptide binding protein/peptideChain: A: PDB Molecule:periplasmic murein peptide-binding protein; PDBTitle: the structure of the escherichia coli murein tripeptide binding2 protein mppa
Resolution2.07 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   634.....640.........650.........660.........670.........680.........690.........700.........710...
Predicted Secondary structure 


























Query SS confidence 















































































Query Sequence  DRHEDADKANQALKDAVAELMENEEIRGLIIGEPNFAGIVGLSNTAFTLRVSFTTLPLKQWTVRFALDSQVKKHFDLAGV
Query Conservation   
  
   
  

                
  
     
  
  
 
               
       
   
   

Alig confidence 

















.........................
















..

















Template Conservation          
  

  

 .........................  
      
       ..                

Template Sequence  SQEELNAQAKTLLSAAGY. . . . . . . . . . . . . . . . . . . . . . . . . GPQKPLKLTLLYNTSEN. . HQKIAIAVASMWKKNLGV
Template Known Secondary structure 
T
.........................BTTB

S
..

Template Predicted Secondary structure 
.........................









..


Template SS confidence 















































































   334.....340.........350. ........360........ .370.........380......
 
   714.
Predicted Secondary structure 

Query SS confidence 

Query Sequence  RA
Query Conservation 

Alig confidence 

Template Conservation   
Template Sequence  DV
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   387.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions