Return to main results Retrieve Phyre Job Id

Job DescriptionP75783
Confidence22.85%DateThu Jan 5 12:14:05 GMT 2012
Rank275Aligned Residues35
% Identity14%Templatec3iwcD_
PDB info PDB header:lyaseChain: D: PDB Molecule:s-adenosylmethionine decarboxylase; PDBTitle: t. maritima adometdc complex with s-adenosylmethionine2 methyl ester
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   637..640.........650.........660.........670.........680.
Predicted Secondary structure 


















Query SS confidence 












































Query Sequence  EDADKANQALKDAVAELMENEEIRGLIIGEPNFAGIVGLSNTAFT
Query Conservation   
   
  

                
  
     
  
  
 
 
Alig confidence 



















......


....











Template Conservation   
   
   
  

   


......

 ....   
 
 
 


Template Sequence  DNVQLIEQEMKQAAYESGAT. . . . . . IVT. . . . STFHRFLPYGVS
Template Known Secondary structure  T
T
..........
SSS
Template Predicted Secondary structure 



..........



Template SS confidence 












































   21........30.........40 ... ......50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions