Return to main results Retrieve Phyre Job Id

Job DescriptionP75783
Confidence71.80%DateThu Jan 5 12:14:05 GMT 2012
Rank13Aligned Residues38
% Identity16%Templatec2zkrt_
PDB info PDB header:ribosomal protein/rnaChain: T: PDB Molecule:rna expansion segment es39 part iii; PDBTitle: structure of a mammalian ribosomal 60s subunit within an2 80s complex obtained by docking homology models of the rna3 and proteins into an 8.7 a cryo-em map
Resolution8.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   573......580.. .... ...590.........600. ........610
Predicted Secondary structure 





.....

........



Query SS confidence 









. . . . .



.














. . . . . . .








Query Sequence  GMNTGDLVTI. . . . . GPLT. GTVERMSIRSVGVRQ. . . . . . . DTGAYHIIP
Query Conservation     


 
 
..... 
  .
 
  
 



 

 ....... 

   


Alig confidence 









.....



.














.......








Template Conservation 





 
 
 

  

 
 


  
      
 




  
  
  
  
Template Sequence  PIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVG
Template Known Secondary structure  B

TT

SSTTTT

STTTTTT

SS



Template Predicted Secondary structure 




















Template SS confidence 


















































   48.50.........60.........70.........80.........90........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions