Return to main results Retrieve Phyre Job Id

Job DescriptionP75783
Confidence23.70%DateThu Jan 5 12:14:05 GMT 2012
Rank236Aligned Residues33
% Identity15%Templatec2wlvA_
PDB info PDB header:virus proteinChain: A: PDB Molecule:gag polyprotein; PDBTitle: structure of the n-terminal capsid domain of hiv-2
Resolution1.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   698.700.........710.........720.........730.........
Predicted Secondary structure 






















Query SS confidence 









































Query Sequence  FALDSQVKKHFDLAGVRAPVQTYQVLPAPGATPAEPLPPGEP
Query Conservation        
   
   






   
             
   
Alig confidence 
















........



.











Template Conservation 

  




 


 
 
........


 .

  

 
 
 
Template Sequence  QAAMQIIREIINEEAAE. . . . . . . . WDVQ. HPIPGPLPAGQL
Template Known Secondary structure  ........T.







TTS
Template Predicted Secondary structure  .........











Template SS confidence 









































   62.......70........ .80.. .......90....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions