Return to main results Retrieve Phyre Job Id

Job DescriptionP46887
Confidence21.83%DateThu Jan 5 12:04:35 GMT 2012
Rank7Aligned Residues39
% Identity10%Templatec3c1dA_
PDB info PDB header:recombination, dna binding proteinChain: A: PDB Molecule:regulatory protein recx; PDBTitle: x-ray crystal structure of recx
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.........50.........60
Predicted Secondary structure 

















Query SS confidence 



















































Query Sequence  VLNMMIESGEQYTHASLEAAIKARFGEQARFHTCSAEGMTAGELVAFLAAKG
Query Conservation 





 
   

  

   
   

  
 




 
 
    

 

  

Alig confidence 




..





















...........











Template Conservation 

  
..  
  
  

  

  
   
 ...........

 

  
 
 
Template Sequence  AVRIL. . AVRDHSEQELRRKLAAPATAED. . . . . . . . . . . YERVIAWCHEHG
Template Known Secondary structure  ..TTS






...........TT
Template Predicted Secondary structure  ..



...........

Template SS confidence 



















































   18.20.. .......30.........40.... .....50......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions