Return to main results Retrieve Phyre Job Id

Job DescriptionP37182
Confidence81.41%DateThu Jan 5 11:54:57 GMT 2012
Rank20Aligned Residues30
% Identity23%Templatec3g17H_
PDB info PDB header:structural genomics, unknown functionChain: H: PDB Molecule:similar to 2-dehydropantoate 2-reductase; PDBTitle: structure of putative 2-dehydropantoate 2-reductase from2 staphylococcus aureus
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40
Predicted Secondary structure 















Query SS confidence 







































Query Sequence  MRILVLGVGNILLTDEAIGVRIVEALEQRYILPDYVEILD
Query Conservation 









 
 





  
   
      
  
  

Alig confidence 










.......











...






Template Conservation 


 


 
  .......
   
  
   
...  
    
Template Sequence  LSVAIIGPGAV. . . . . . . GTTIAYELQQSL. . . PHTTLIG
Template Known Secondary structure 



S.......
...TT
Template Predicted Secondary structure 



.......

...
Template SS confidence 







































   3......10... ......20..... ....30..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions