Return to main results Retrieve Phyre Job Id

Job DescriptionP37182
Confidence45.17%DateThu Jan 5 11:54:57 GMT 2012
Rank105Aligned Residues28
% Identity39%Templatec3bioB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:oxidoreductase, gfo/idh/moca family; PDBTitle: crystal structure of oxidoreductase (gfo/idh/moca family member) from2 porphyromonas gingivalis w83
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........
Predicted Secondary structure 















Query SS confidence 






































Query Sequence  MRILVLGVGNILLTDEAIGVRIVEALEQRYILPDYVEIL
Query Conservation 









 
 





  
   
      
  
  
Alig confidence 










.......










....





Template Conservation 


 
 
 
 
.......
          ....   


Template Sequence  IRAAIVGYGNI. . . . . . . GRYALQALREA. . . . PDFEIA
Template Known Secondary structure 

S.......
....TT
Template Predicted Secondary structure 


.......
....


Template SS confidence 






































   7..10....... ..20........ .30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions