Return to main results Retrieve Phyre Job Id

Job DescriptionP29013
Confidence9.87%DateThu Jan 5 11:45:33 GMT 2012
Rank82Aligned Residues25
% Identity16%Templated1xrsb2
SCOP infoDodecin subunit-like D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain
Resolution2.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40...
Predicted Secondary structure 















Query SS confidence 
































Query Sequence  TTRLSDGPDWTFDLLDVYLAEIDRVAKLYRLDT
Query Conservation        
 
     
     

 
 
   



Alig confidence 






........

















Template Conservation 




  ........


 


 


 



  
Template Sequence  TLPLKNN. . . . . . . . ERSAEAAKQIALKMGLEE
Template Known Secondary structure  SS
SS........TTSS

Template Predicted Secondary structure 



........



Template SS confidence 
































   3940..... ....50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions