Return to main results Retrieve Phyre Job Id

Job DescriptionP29013
Confidence11.97%DateThu Jan 5 11:45:33 GMT 2012
Rank57Aligned Residues31
% Identity29%Templatec3ezkB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:dna packaging protein gp17; PDBTitle: bacteriophage t4 gp17 motor assembly based on crystal2 structures and cryo-em reconstructions
Resolution34.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   237..240. ........250.. .......260.......
Predicted Secondary structure 


...

...........


Query SS confidence 




. . .










. . . . . . . . . . .














Query Sequence  SEPQE. . . NLLYFMEKNAP. . . . . . . . . . . LLESWQREILRIVRK
Query Conservation 
 

 ...


 

   

........... 








 



Alig confidence 




...










...........














Template Conservation          
   
      
         
 
   
   
     
Template Sequence  EEWKKCRDDIVYFAETYCAITHIDYGVIKVQLRDYQRDMLKIMSS
Template Known Secondary structure 


SSS




Template Predicted Secondary structure 








Template SS confidence 












































   108.110.........120.........130.........140.........150..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions