Return to main results Retrieve Phyre Job Id

Job DescriptionP29013
Confidence10.65%DateThu Jan 5 11:45:33 GMT 2012
Rank69Aligned Residues24
% Identity29%Templatec3e38A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:two-domain protein containing predicted php-like metal- PDBTitle: crystal structure of a two-domain protein containing predicted php-2 like metal-dependent phosphoesterase (bvu_3505) from bacteroides3 vulgatus atcc 8482 at 2.20 a resolution
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40...
Predicted Secondary structure 














Query SS confidence 































Query Sequence  TRLSDGPDWTFDLLDVYLAEIDRVAKLYRLDT
Query Conservation       
 
     
     

 
 
   



Alig confidence 





........

















Template Conservation 
  


........  

 
 
  
   


 
Template Sequence  SVFSDG. . . . . . . . LVWPTVRVDEAYRDGLDA
Template Known Secondary structure 
TTTT
........SS
TT
S
Template Predicted Secondary structure 





........






Template SS confidence 































   47..50.. .......60.........70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions