Return to main results Retrieve Phyre Job Id

Job DescriptionP29013
Confidence28.54%DateThu Jan 5 11:45:33 GMT 2012
Rank17Aligned Residues31
% Identity19%Templatec2qffA_
PDB info PDB header:hydrolase inhibitorChain: A: PDB Molecule:hypothetical protein; PDBTitle: crystal structure of staphylococcal complement inhibitor
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   288.290.........300.........310.........320.........330......
Predicted Secondary structure 

























Query SS confidence 
















































Query Sequence  FWHYTILNHLYDEGKVTERFMLEFLHSHTNVVFQPPYNSPWYSGINPYA
Query Conservation 


  

 

     
   
 



  

 

       
    



 
Alig confidence 









...


.......










........






Template Conservation 
 
 


 

...
 
.......


 

  


........






Template Sequence  YQNEKLANEL. . . KSL. . . . . . . LDELNVNELAT. . . . . . . . GSLNTYY
Template Known Secondary structure  ..........TTG........GGS
Template Predicted Secondary structure 

..........

........



Template SS confidence 
















































   10......... 20.. .......30... ......40
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions