Return to main results Retrieve Phyre Job Id

Job DescriptionP29013
Confidence10.32%DateThu Jan 5 11:45:33 GMT 2012
Rank73Aligned Residues24
% Identity13%Templatec1w9iA_
PDB info PDB header:myosinChain: A: PDB Molecule:myosin ii heavy chain; PDBTitle: myosin ii dictyostelium discoideum motor domain s456y bound2 with mgadp-befx
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   60.........70.........80.........90....
Predicted Secondary structure 


















Query SS confidence 


































Query Sequence  YSSVGMPINYPHWSFGKKFIETERLYKHGQQGLAY
Query Conservation   
  
 
 








 
 
 
  
  


 
 
Alig confidence 














..........







.
Template Conservation 
 
 


 
  
 

..........
  
 


.
Template Sequence  ITRKGFPNRIIYADQ. . . . . . . . . . FRFGITKI. F
Template Known Secondary structure  TTSS

S


..........



SS.
Template Predicted Secondary structure 







..........



.
Template SS confidence 


































   687..690.........700. ........ 710
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions