Return to main results Retrieve Phyre Job Id

Job DescriptionP08204
Confidence97.37%DateThu Jan 5 11:00:58 GMT 2012
Rank57Aligned Residues65
% Identity25%Templatec3vgkB_
PDB info PDB header:transferaseChain: B: PDB Molecule:glucokinase; PDBTitle: crystal structure of a rok family glucokinase from streptomyces2 griseus
Resolution3.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60.........70.........80..
Predicted Secondary structure 






























Query SS confidence 















































































Query Sequence  IAIGLDFGSDSVRALAVDCATGEEIATSVEWYPRWQKGQFCDAPNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAVVG
Query Conservation    








 
  
 
   
 
                        
 

          
              
 
Alig confidence 

















.













................



















......




Template Conservation    



 


     
 
.  
 
         ................         
   
      ......  
  
Template Sequence  LTIGVDIGGTKIAAGVVD. EEGRILSTFKVATP. . . . . . . . . . . . . . . . PTAEGIVDAICAAVAGASEG. . . . . . HDVEA
Template Known Secondary structure  TT
.TT



................SSSSTTTT......

Template Predicted Secondary structure 



.






................

......



Template SS confidence 















































































   3......10.........20 .........30.... .....40.........50.... .....
 
   83......90
Predicted Secondary structure 




Query SS confidence 







Query Sequence  IGVDSTGS
Query Conservation 
 

    
Alig confidence 







Template Conservation 
 
   
 
Template Sequence  VGIGAAGY
Template Known Secondary structure  SS
Template Predicted Secondary structure 



Template SS confidence 







   60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions